Anti LYSMD2 pAb (ATL-HPA040460)

Atlas Antibodies

Catalog No.: ATL-HPA040460-25

Protein Description: LysM, putative peptidoglycan-binding, domain containing 2
Gene Name: LYSMD2
Alternative Gene Name: MGC35274
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032184: 83%, ENSRNOG00000010642: 80%
Entrez Gene ID: 256586
Uniprot ID: Q8IV50
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LNIPVISEKPLLFNGLNSIDSPENETADNSFSQEEEPVVAGEDLPPPSPQESDVQPVQPEEVSARDFLQRLDLQIKLSTQAAKKLKEESRDEESPYATSLY
• Gene Sequence: LNIPVISEKPLLFNGLNSIDSPENETADNSFSQEEEPVVAGEDLPPPSPQESDVQPVQPEEVSARDFLQRLDLQIKLSTQAAKKLKEESRDEESPYATSLY
• Gene ID - Mouse: ENSMUSG00000032184
• Gene ID - Rat: ENSRNOG00000010642
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.