Anti LUM pAb (ATL-HPA001522)

Atlas Antibodies

Catalog No.: ATL-HPA001522-25

Protein Description: lumican
Gene Name: LUM
Alternative Gene Name: LDC, SLRR2D
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036446: 91%, ENSRNOG00000004610: 89%
Entrez Gene ID: 4060
Uniprot ID: P51884
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTF
• Gene Sequence: DFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTF
• Gene ID - Mouse: ENSMUSG00000036446
• Gene ID - Rat: ENSRNOG00000004610
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LUM pAb (ATL-HPA001522) – 3 Found

de Wit, Meike; Carvalho, Beatriz; Delis-van Diemen, Pien M; van Alphen, Carolien; Beliën, Jeroen A M; Meijer, Gerrit A; Fijneman, Remond J A. Lumican and versican protein expression are associated with colorectal adenoma-to-carcinoma progression. Plos One. 12(5):e0174768. 

Jeanne, Albin; Untereiner, Valérie; Perreau, Corinne; Proult, Isabelle; Gobinet, Cyril; Boulagnon-Rombi, Camille; Terryn, Christine; Martiny, Laurent; Brézillon, Stéphane; Dedieu, Stéphane. Lumican delays melanoma growth in mice and drives tumor molecular assembly as well as response to matrix-targeted TAX2 therapeutic peptide. Scientific Reports. 2017;7(1):7700. 

de Wit, Meike; Belt, Eric J Th; Delis-van Diemen, Pien M; Carvalho, Beatriz; Coupé, Veerle M H; Stockmann, Hein B A C; Bril, Herman; Beliën, Jeroen A M; Fijneman, Remond J A; Meijer, Gerrit A. Lumican and versican are associated with good outcome in stage II and III colon cancer. Annals Of Surgical Oncology. 2013;20 Suppl 3(Suppl 3):S348-59.