Anti LTB4R pAb (ATL-HPA003873 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003873-25

Protein Description: leukotriene B4 receptor
Gene Name: LTB4R
Alternative Gene Name: BLTR, CMKRL1, GPR16, LTB4R1, P2RY7, P2Y7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046908: 61%, ENSRNOG00000020399: 60%
Entrez Gene ID: 1241
Uniprot ID: Q15722
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNE
• Gene Sequence: GVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNE
• Gene ID - Mouse: ENSMUSG00000046908
• Gene ID - Rat: ENSRNOG00000020399
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LTB4R pAb (ATL-HPA003873 w/enhanced validation) – 1 Found

Qundos, Ulrika; Hong, Mun-Gwan; Tybring, Gunnel; Divers, Mark; Odeberg, Jacob; Uhlen, Mathias; Nilsson, Peter; Schwenk, Jochen M. Profiling post-centrifugation delay of serum and plasma with antibody bead arrays. Journal Of Proteomics. 2013;95( 23631827):46-54.