Anti LSP1 pAb (ATL-HPA019693 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019693-25

Protein Description: lymphocyte-specific protein 1
Gene Name: LSP1
Alternative Gene Name: WP34
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018819: 82%, ENSRNOG00000020300: 82%
Entrez Gene ID: 4046
Uniprot ID: P33241
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PRTPSPLVLEGTIEQSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPISKIDQWLEQYTQAIETAGRTPKLARQASIELPSMAVASTK
• Gene Sequence: PRTPSPLVLEGTIEQSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPISKIDQWLEQYTQAIETAGRTPKLARQASIELPSMAVASTK
• Gene ID - Mouse: ENSMUSG00000018819
• Gene ID - Rat: ENSRNOG00000020300
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LSP1 pAb (ATL-HPA019693 w/enhanced validation) – 2 Found

Johansson, Joel; Tabor, Vedrana; Wikell, Anna; Jalkanen, Sirpa; Fuxe, Jonas. TGF-β1-Induced Epithelial-Mesenchymal Transition Promotes Monocyte/Macrophage Properties in Breast Cancer Cells. Frontiers In Oncology. 5( 25674539):3. 

Cervero, Pasquale; Wiesner, Christiane; Bouissou, Anais; Poincloux, Renaud; Linder, Stefan. Lymphocyte-specific protein 1 regulates mechanosensory oscillation of podosomes and actin isoform-based actomyosin symmetry breaking. Nature Communications. 2018;9(1):515.