Anti LSM7 pAb (ATL-HPA041850)

Atlas Antibodies

Catalog No.: ATL-HPA041850-25

Protein Description: LSM7 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Gene Name: LSM7
Alternative Gene Name: YNL147W
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035215: 96%, ENSRNOG00000019552: 97%
Entrez Gene ID: 51690
Uniprot ID: Q9UK45
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RSGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQD
• Gene Sequence: RSGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTSVVLICPQDGMEAIPNPFIQQQD
• Gene ID - Mouse: ENSMUSG00000035215
• Gene ID - Rat: ENSRNOG00000019552
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.