Anti LSM6 pAb (ATL-HPA045079)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045079-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: LSM6
Alternative Gene Name: YDR378C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031683: 100%, ENSRNOG00000049370: 100%
Entrez Gene ID: 11157
Uniprot ID: P62312
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM |
| Gene Sequence | MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM |
| Gene ID - Mouse | ENSMUSG00000031683 |
| Gene ID - Rat | ENSRNOG00000049370 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LSM6 pAb (ATL-HPA045079) | |
| Datasheet | Anti LSM6 pAb (ATL-HPA045079) Datasheet (External Link) |
| Vendor Page | Anti LSM6 pAb (ATL-HPA045079) at Atlas Antibodies |
| Documents & Links for Anti LSM6 pAb (ATL-HPA045079) | |
| Datasheet | Anti LSM6 pAb (ATL-HPA045079) Datasheet (External Link) |
| Vendor Page | Anti LSM6 pAb (ATL-HPA045079) |