Anti LSM4 pAb (ATL-HPA040932)

Atlas Antibodies

Catalog No.: ATL-HPA040932-25

Protein Description: LSM4 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Gene Name: LSM4
Alternative Gene Name: YER112W
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110900: 100%, ENSRNOG00000019572: 100%
Entrez Gene ID: 25804
Uniprot ID: Q9Y4Z0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIID
• Gene Sequence: MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIID
• Gene ID - Mouse: ENSMUSG00000110900
• Gene ID - Rat: ENSRNOG00000019572
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LSM4 pAb (ATL-HPA040932) – 1 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.