Anti LRTOMT pAb (ATL-HPA039949 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA039949-25

Protein Description: leucine rich transmembrane and O-methyltransferase domain containing
Gene Name: LRTOMT
Alternative Gene Name: CFAP111, COMT2, DFNB63, LRRC51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064307: 85%, ENSRNOG00000020124: 87%
Entrez Gene ID: 220074
Uniprot ID: Q96E66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSLTQSLWLNNNVLNDLRDFNQVASQLLEHPENLAWIDLSFNDLTSIDPV
• Gene Sequence: MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSLTQSLWLNNNVLNDLRDFNQVASQLLEHPENLAWIDLSFNDLTSIDPV
• Gene ID - Mouse: ENSMUSG00000064307
• Gene ID - Rat: ENSRNOG00000020124
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.