Anti LRTOMT pAb (ATL-HPA039949 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039949-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: LRTOMT
Alternative Gene Name: CFAP111, COMT2, DFNB63, LRRC51
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064307: 85%, ENSRNOG00000020124: 87%
Entrez Gene ID: 220074
Uniprot ID: Q96E66
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSLTQSLWLNNNVLNDLRDFNQVASQLLEHPENLAWIDLSFNDLTSIDPV |
| Gene Sequence | MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSLTQSLWLNNNVLNDLRDFNQVASQLLEHPENLAWIDLSFNDLTSIDPV |
| Gene ID - Mouse | ENSMUSG00000064307 |
| Gene ID - Rat | ENSRNOG00000020124 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LRTOMT pAb (ATL-HPA039949 w/enhanced validation) | |
| Datasheet | Anti LRTOMT pAb (ATL-HPA039949 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti LRTOMT pAb (ATL-HPA039949 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti LRTOMT pAb (ATL-HPA039949 w/enhanced validation) | |
| Datasheet | Anti LRTOMT pAb (ATL-HPA039949 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti LRTOMT pAb (ATL-HPA039949 w/enhanced validation) |