Anti LRSAM1 pAb (ATL-HPA021403 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA021403-25

Protein Description: leucine rich repeat and sterile alpha motif containing 1
Gene Name: LRSAM1
Alternative Gene Name: FLJ31641
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026792: 90%, ENSRNOG00000022312: 91%
Entrez Gene ID: 90678
Uniprot ID: Q6UWE0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LENERIRMEQLMSITQEETESLRRRDVASAMQQMLTESCKNRLIQMAYESQRQNLVQQACSSMAEMDERFQQILSWQQMDQNKAISQI
• Gene Sequence: LENERIRMEQLMSITQEETESLRRRDVASAMQQMLTESCKNRLIQMAYESQRQNLVQQACSSMAEMDERFQQILSWQQMDQNKAISQI
• Gene ID - Mouse: ENSMUSG00000026792
• Gene ID - Rat: ENSRNOG00000022312
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LRSAM1 pAb (ATL-HPA021403 w/enhanced validation) – 1 Found

Bogdanik, Laurent P; Sleigh, James N; Tian, Cong; Samuels, Mark E; Bedard, Karen; Seburn, Kevin L; Burgess, Robert W. Loss of the E3 ubiquitin ligase LRSAM1 sensitizes peripheral axons to degeneration in a mouse model of Charcot-Marie-Tooth disease. Disease Models & Mechanisms. 2013;6(3):780-92.