Anti LRRIQ4 pAb (ATL-HPA036706)

Atlas Antibodies

Catalog No.: ATL-HPA036706-25

Protein Description: leucine-rich repeats and IQ motif containing 4
Gene Name: LRRIQ4
Alternative Gene Name: LRRC64
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027703: 77%, ENSRNOG00000009004: 78%
Entrez Gene ID: 344657
Uniprot ID: A6NIV6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MPNLEVLDCRHNLLKQLPDAICQAQALKELRLEDNLLTHLPENLDSLVNLKVLTLMDNPMEEPPKEVCAEGNEAIWKYLKENRNRNIMATK
• Gene Sequence: MPNLEVLDCRHNLLKQLPDAICQAQALKELRLEDNLLTHLPENLDSLVNLKVLTLMDNPMEEPPKEVCAEGNEAIWKYLKENRNRNIMATK
• Gene ID - Mouse: ENSMUSG00000027703
• Gene ID - Rat: ENSRNOG00000009004
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.