Anti LRRIQ3 pAb (ATL-HPA030799)

Atlas Antibodies

Catalog No.: ATL-HPA030799-100

Protein Description: leucine-rich repeats and IQ motif containing 3
Gene Name: LRRIQ3
Alternative Gene Name: LRRC44, MGC22773
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028182: 88%, ENSRNOG00000009555: 89%
Entrez Gene ID: 127255
Uniprot ID: A6PVS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MFHGTVTEELTSHEEWSHYNENIREGQKDFVFVKFNGLHLKSMENLQSCISLRVCIFSNNFITDIHPLQSCIKLIKLDLHGN
• Gene Sequence: MFHGTVTEELTSHEEWSHYNENIREGQKDFVFVKFNGLHLKSMENLQSCISLRVCIFSNNFITDIHPLQSCIKLIKLDLHGN
• Gene ID - Mouse: ENSMUSG00000028182
• Gene ID - Rat: ENSRNOG00000009555
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.