Anti LRRC9 pAb (ATL-HPA041381)

Atlas Antibodies

Catalog No.:
ATL-HPA041381-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 9
Gene Name: LRRC9
Alternative Gene Name: FLJ46156
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021090: 89%, ENSRNOG00000005409: 89%
Entrez Gene ID:
Uniprot ID: Q6ZRR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESENLNQEEIIKELCLCNGLSYEMVGQEGSDTSKLEMFFLGYPRIVGLSLFPNLTSLTIVAQDIKEISGLEPCLQLKELWIAEC
Gene Sequence ESENLNQEEIIKELCLCNGLSYEMVGQEGSDTSKLEMFFLGYPRIVGLSLFPNLTSLTIVAQDIKEISGLEPCLQLKELWIAEC
Gene ID - Mouse ENSMUSG00000021090
Gene ID - Rat ENSRNOG00000005409
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRC9 pAb (ATL-HPA041381)
Datasheet Anti LRRC9 pAb (ATL-HPA041381) Datasheet (External Link)
Vendor Page Anti LRRC9 pAb (ATL-HPA041381) at Atlas Antibodies

Documents & Links for Anti LRRC9 pAb (ATL-HPA041381)
Datasheet Anti LRRC9 pAb (ATL-HPA041381) Datasheet (External Link)
Vendor Page Anti LRRC9 pAb (ATL-HPA041381)