Anti LRRC74A pAb (ATL-HPA035094)

Atlas Antibodies

Catalog No.:
ATL-HPA035094-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 74A
Gene Name: LRRC74A
Alternative Gene Name: C14orf166B, LRRC74
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059114: 61%, ENSRNOG00000052456: 59%
Entrez Gene ID: 145497
Uniprot ID: Q0VAA2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLTNPMKLIQSYADQHKITIVDFFKSLNPTGTMKMSVDEFQKVMIEQNKVPLNQYQVREVIKKLDEKTGMVNFSFLNTMK
Gene Sequence LLTNPMKLIQSYADQHKITIVDFFKSLNPTGTMKMSVDEFQKVMIEQNKVPLNQYQVREVIKKLDEKTGMVNFSFLNTMK
Gene ID - Mouse ENSMUSG00000059114
Gene ID - Rat ENSRNOG00000052456
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRC74A pAb (ATL-HPA035094)
Datasheet Anti LRRC74A pAb (ATL-HPA035094) Datasheet (External Link)
Vendor Page Anti LRRC74A pAb (ATL-HPA035094) at Atlas Antibodies

Documents & Links for Anti LRRC74A pAb (ATL-HPA035094)
Datasheet Anti LRRC74A pAb (ATL-HPA035094) Datasheet (External Link)
Vendor Page Anti LRRC74A pAb (ATL-HPA035094)