Anti LRRC59 pAb (ATL-HPA030827 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA030827-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 59
Gene Name: LRRC59
Alternative Gene Name: FLJ21675, PRO1855
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020869: 93%, ENSRNOG00000059189: 93%
Entrez Gene ID: 55379
Uniprot ID: Q96AG4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen CRVTELQQQPLCTSVNTIYDNAVQGLRRHEILQWVLQTDSQQ
Gene Sequence CRVTELQQQPLCTSVNTIYDNAVQGLRRHEILQWVLQTDSQQ
Gene ID - Mouse ENSMUSG00000020869
Gene ID - Rat ENSRNOG00000059189
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRC59 pAb (ATL-HPA030827 w/enhanced validation)
Datasheet Anti LRRC59 pAb (ATL-HPA030827 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LRRC59 pAb (ATL-HPA030827 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti LRRC59 pAb (ATL-HPA030827 w/enhanced validation)
Datasheet Anti LRRC59 pAb (ATL-HPA030827 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LRRC59 pAb (ATL-HPA030827 w/enhanced validation)
Citations for Anti LRRC59 pAb (ATL-HPA030827 w/enhanced validation) – 1 Found
Maurizio, Elisa; Wiśniewski, Jacek R; Ciani, Yari; Amato, Angela; Arnoldo, Laura; Penzo, Carlotta; Pegoraro, Silvia; Giancotti, Vincenzo; Zambelli, Alberto; Piazza, Silvano; Manfioletti, Guidalberto; Sgarra, Riccardo. Translating Proteomic Into Functional Data: An High Mobility Group A1 (HMGA1) Proteomic Signature Has Prognostic Value in Breast Cancer. Molecular & Cellular Proteomics : Mcp. 2016;15(1):109-23.  PubMed