Anti LRRC49 pAb (ATL-HPA015596)

Atlas Antibodies

Catalog No.: ATL-HPA015596-25

Protein Description: leucine rich repeat containing 49
Gene Name: LRRC49
Alternative Gene Name: FLJ20156
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047766: 92%, ENSRNOG00000012015: 92%
Entrez Gene ID: 54839
Uniprot ID: Q8IUZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SHVDNLNGLDSLTELNLRHNQITFVRDVDNLPCLQHLFLSFNNISSFDSVSCLADSSSLSDITFDGNPIAQESWYKHTVLQNMMQLRQLDMKRITEEERRMASVLAKKEEEKKRESHKQSLLKEKKRLTINNVARQWDLQQQRVA
• Gene Sequence: SHVDNLNGLDSLTELNLRHNQITFVRDVDNLPCLQHLFLSFNNISSFDSVSCLADSSSLSDITFDGNPIAQESWYKHTVLQNMMQLRQLDMKRITEEERRMASVLAKKEEEKKRESHKQSLLKEKKRLTINNVARQWDLQQQRVA
• Gene ID - Mouse: ENSMUSG00000047766
• Gene ID - Rat: ENSRNOG00000012015
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.