Anti LRRC38 pAb (ATL-HPA038778)

Atlas Antibodies

Catalog No.:
ATL-HPA038778-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 38
Gene Name: LRRC38
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097351: 88%, ENSRNOG00000015264: 89%
Entrez Gene ID: 126755
Uniprot ID: Q5VT99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NNLVGVHEDAFETLESLQVLELNDNNLRSLSVAALAALPALRSLRLDGNPWLCDCDFAHLFSWIQENASKLPK
Gene Sequence NNLVGVHEDAFETLESLQVLELNDNNLRSLSVAALAALPALRSLRLDGNPWLCDCDFAHLFSWIQENASKLPK
Gene ID - Mouse ENSMUSG00000097351
Gene ID - Rat ENSRNOG00000015264
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRC38 pAb (ATL-HPA038778)
Datasheet Anti LRRC38 pAb (ATL-HPA038778) Datasheet (External Link)
Vendor Page Anti LRRC38 pAb (ATL-HPA038778) at Atlas Antibodies

Documents & Links for Anti LRRC38 pAb (ATL-HPA038778)
Datasheet Anti LRRC38 pAb (ATL-HPA038778) Datasheet (External Link)
Vendor Page Anti LRRC38 pAb (ATL-HPA038778)