Anti LRRC37A pAb (ATL-HPA042121)
Atlas Antibodies
- Catalog No.:
- ATL-HPA042121-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: LRRC37A
Alternative Gene Name: KIAA0563
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069539: 39%, ENSRNOG00000042025: 42%
Entrez Gene ID: 9884
Uniprot ID: A6NMS7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EQFLASQQDLKDKLSPQERLPVSPKKLKKDPAQRWS |
| Gene Sequence | EQFLASQQDLKDKLSPQERLPVSPKKLKKDPAQRWS |
| Gene ID - Mouse | ENSMUSG00000069539 |
| Gene ID - Rat | ENSRNOG00000042025 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LRRC37A pAb (ATL-HPA042121) | |
| Datasheet | Anti LRRC37A pAb (ATL-HPA042121) Datasheet (External Link) |
| Vendor Page | Anti LRRC37A pAb (ATL-HPA042121) at Atlas Antibodies |
| Documents & Links for Anti LRRC37A pAb (ATL-HPA042121) | |
| Datasheet | Anti LRRC37A pAb (ATL-HPA042121) Datasheet (External Link) |
| Vendor Page | Anti LRRC37A pAb (ATL-HPA042121) |