Anti LRRC37A pAb (ATL-HPA042121)

Atlas Antibodies

Catalog No.: ATL-HPA042121-25

Protein Description: leucine rich repeat containing 37A
Gene Name: LRRC37A
Alternative Gene Name: KIAA0563
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069539: 39%, ENSRNOG00000042025: 42%
Entrez Gene ID: 9884
Uniprot ID: A6NMS7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EQFLASQQDLKDKLSPQERLPVSPKKLKKDPAQRWS
• Gene Sequence: EQFLASQQDLKDKLSPQERLPVSPKKLKKDPAQRWS
• Gene ID - Mouse: ENSMUSG00000069539
• Gene ID - Rat: ENSRNOG00000042025
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.