Anti LRRC34 pAb (ATL-HPA035747)

Atlas Antibodies

Catalog No.:
ATL-HPA035747-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 34
Gene Name: LRRC34
Alternative Gene Name: MGC27085
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027702: 64%, ENSRNOG00000027935: 64%
Entrez Gene ID: 151827
Uniprot ID: Q8IZ02
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LHILQEVDEEIKKGLAAGITLNIAGNNRLVPVERVTGEDFWILSKILKNCLYINGLDVGYNLLCDVGAYYAAKLLQKQ
Gene Sequence LHILQEVDEEIKKGLAAGITLNIAGNNRLVPVERVTGEDFWILSKILKNCLYINGLDVGYNLLCDVGAYYAAKLLQKQ
Gene ID - Mouse ENSMUSG00000027702
Gene ID - Rat ENSRNOG00000027935
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRC34 pAb (ATL-HPA035747)
Datasheet Anti LRRC34 pAb (ATL-HPA035747) Datasheet (External Link)
Vendor Page Anti LRRC34 pAb (ATL-HPA035747) at Atlas Antibodies

Documents & Links for Anti LRRC34 pAb (ATL-HPA035747)
Datasheet Anti LRRC34 pAb (ATL-HPA035747) Datasheet (External Link)
Vendor Page Anti LRRC34 pAb (ATL-HPA035747)