Anti LRRC30 pAb (ATL-HPA041039)

Atlas Antibodies

Catalog No.:
ATL-HPA041039-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 30
Gene Name: LRRC30
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073375: 89%, ENSRNOG00000030389: 88%
Entrez Gene ID: 339291
Uniprot ID: A6NM36
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HNQLRVLPPEVGKLTRIVVLNLCGNRLKSLPREVSLLQCLKVLFVSMNCLTEVPAELSLCRKLEVLSLSHNCLSQ
Gene Sequence HNQLRVLPPEVGKLTRIVVLNLCGNRLKSLPREVSLLQCLKVLFVSMNCLTEVPAELSLCRKLEVLSLSHNCLSQ
Gene ID - Mouse ENSMUSG00000073375
Gene ID - Rat ENSRNOG00000030389
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRC30 pAb (ATL-HPA041039)
Datasheet Anti LRRC30 pAb (ATL-HPA041039) Datasheet (External Link)
Vendor Page Anti LRRC30 pAb (ATL-HPA041039) at Atlas Antibodies

Documents & Links for Anti LRRC30 pAb (ATL-HPA041039)
Datasheet Anti LRRC30 pAb (ATL-HPA041039) Datasheet (External Link)
Vendor Page Anti LRRC30 pAb (ATL-HPA041039)