Anti LRRC30 pAb (ATL-HPA041039)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041039-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: LRRC30
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073375: 89%, ENSRNOG00000030389: 88%
Entrez Gene ID: 339291
Uniprot ID: A6NM36
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HNQLRVLPPEVGKLTRIVVLNLCGNRLKSLPREVSLLQCLKVLFVSMNCLTEVPAELSLCRKLEVLSLSHNCLSQ |
| Gene Sequence | HNQLRVLPPEVGKLTRIVVLNLCGNRLKSLPREVSLLQCLKVLFVSMNCLTEVPAELSLCRKLEVLSLSHNCLSQ |
| Gene ID - Mouse | ENSMUSG00000073375 |
| Gene ID - Rat | ENSRNOG00000030389 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LRRC30 pAb (ATL-HPA041039) | |
| Datasheet | Anti LRRC30 pAb (ATL-HPA041039) Datasheet (External Link) |
| Vendor Page | Anti LRRC30 pAb (ATL-HPA041039) at Atlas Antibodies |
| Documents & Links for Anti LRRC30 pAb (ATL-HPA041039) | |
| Datasheet | Anti LRRC30 pAb (ATL-HPA041039) Datasheet (External Link) |
| Vendor Page | Anti LRRC30 pAb (ATL-HPA041039) |