Anti LRRC2 pAb (ATL-HPA040096)

Atlas Antibodies

Catalog No.: ATL-HPA040096-25

Protein Description: leucine rich repeat containing 2
Gene Name: LRRC2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032495: 86%, ENSRNOG00000030688: 83%
Entrez Gene ID: 79442
Uniprot ID: Q9BYS8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LREWYISNTLIQIIPTYIQLFQAMRILDLPKNQISHLPAEIGCLKNLKELNVGFNYLKSIPPELGDCENLERLDCSGN
• Gene Sequence: LREWYISNTLIQIIPTYIQLFQAMRILDLPKNQISHLPAEIGCLKNLKELNVGFNYLKSIPPELGDCENLERLDCSGN
• Gene ID - Mouse: ENSMUSG00000032495
• Gene ID - Rat: ENSRNOG00000030688
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.