Anti LRRC14B pAb (ATL-HPA038047)

Atlas Antibodies

Catalog No.:
ATL-HPA038047-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: leucine rich repeat containing 14B
Gene Name: LRRC14B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021579: 84%, ENSRNOG00000028357: 85%
Entrez Gene ID: 389257
Uniprot ID: A6NHZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GALRKLEVVHNVRLHAGHVQQLLAQVGFPRLASLTLPTKAFDAPPTYASTPDGEDPLLASIARELSKMAQLTELSVAFSTLTGKIPTLL
Gene Sequence GALRKLEVVHNVRLHAGHVQQLLAQVGFPRLASLTLPTKAFDAPPTYASTPDGEDPLLASIARELSKMAQLTELSVAFSTLTGKIPTLL
Gene ID - Mouse ENSMUSG00000021579
Gene ID - Rat ENSRNOG00000028357
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRRC14B pAb (ATL-HPA038047)
Datasheet Anti LRRC14B pAb (ATL-HPA038047) Datasheet (External Link)
Vendor Page Anti LRRC14B pAb (ATL-HPA038047) at Atlas Antibodies

Documents & Links for Anti LRRC14B pAb (ATL-HPA038047)
Datasheet Anti LRRC14B pAb (ATL-HPA038047) Datasheet (External Link)
Vendor Page Anti LRRC14B pAb (ATL-HPA038047)