Anti LRRC14B pAb (ATL-HPA038046)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038046-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: LRRC14B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021579: 88%, ENSRNOG00000028357: 86%
Entrez Gene ID: 389257
Uniprot ID: A6NHZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LRCIEFPVPKDCYPEGAAYPQDELAMSKFNQQKYDEIAEELRAVLLRADREDIQVSTPLFGSFDPDIQETSNELGAFLLQAFKTAL |
| Gene Sequence | LRCIEFPVPKDCYPEGAAYPQDELAMSKFNQQKYDEIAEELRAVLLRADREDIQVSTPLFGSFDPDIQETSNELGAFLLQAFKTAL |
| Gene ID - Mouse | ENSMUSG00000021579 |
| Gene ID - Rat | ENSRNOG00000028357 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LRRC14B pAb (ATL-HPA038046) | |
| Datasheet | Anti LRRC14B pAb (ATL-HPA038046) Datasheet (External Link) |
| Vendor Page | Anti LRRC14B pAb (ATL-HPA038046) at Atlas Antibodies |
| Documents & Links for Anti LRRC14B pAb (ATL-HPA038046) | |
| Datasheet | Anti LRRC14B pAb (ATL-HPA038046) Datasheet (External Link) |
| Vendor Page | Anti LRRC14B pAb (ATL-HPA038046) |