Anti LRIT2 pAb (ATL-HPA037788)

Atlas Antibodies

Catalog No.:
ATL-HPA037788-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: leucine-rich repeat, immunoglobulin-like and transmembrane domains 2
Gene Name: LRIT2
Alternative Gene Name: AC022389.4, LRRC22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043418: 72%, ENSRNOG00000022726: 74%
Entrez Gene ID: 340745
Uniprot ID: A6NDA9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVISLHVQPAQALHAPDSLSIPSEGNAYIDLRVVKQTVHGILLEWLAVADTSKEEWFTLYIASDEAFRKEVVHIGPGINTYAVDDLLPGTKYE
Gene Sequence LVISLHVQPAQALHAPDSLSIPSEGNAYIDLRVVKQTVHGILLEWLAVADTSKEEWFTLYIASDEAFRKEVVHIGPGINTYAVDDLLPGTKYE
Gene ID - Mouse ENSMUSG00000043418
Gene ID - Rat ENSRNOG00000022726
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LRIT2 pAb (ATL-HPA037788)
Datasheet Anti LRIT2 pAb (ATL-HPA037788) Datasheet (External Link)
Vendor Page Anti LRIT2 pAb (ATL-HPA037788) at Atlas Antibodies

Documents & Links for Anti LRIT2 pAb (ATL-HPA037788)
Datasheet Anti LRIT2 pAb (ATL-HPA037788) Datasheet (External Link)
Vendor Page Anti LRIT2 pAb (ATL-HPA037788)