Anti LMOD3 pAb (ATL-HPA036034 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA036034-25

Protein Description: leiomodin 3 (fetal)
Gene Name: LMOD3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044086: 82%, ENSRNOG00000032443: 80%
Entrez Gene ID: 56203
Uniprot ID: Q0VAK6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VTDKAFKEQRDRPEAQEQSEKKISKLDPKKLALDTSFLKVSTRPSGNQTDLDGSLRRVRKNDPDMKELNLNNIENIPKEMLLDFVNAMKK
• Gene Sequence: VTDKAFKEQRDRPEAQEQSEKKISKLDPKKLALDTSFLKVSTRPSGNQTDLDGSLRRVRKNDPDMKELNLNNIENIPKEMLLDFVNAMKK
• Gene ID - Mouse: ENSMUSG00000044086
• Gene ID - Rat: ENSRNOG00000032443
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LMOD3 pAb (ATL-HPA036034 w/enhanced validation) – 2 Found

Li, Shuang; Mo, Kaiqi; Tian, Hong; Chu, Chen; Sun, Shuna; Tian, Lei; Ding, Sheng; Li, Tong-Ruei; Wu, Xiaohui; Liu, Fang; Zhang, Zhen; Xu, Tian; Sun, Ling V. Lmod2 piggyBac mutant mice exhibit dilated cardiomyopathy. Cell & Bioscience. 6( 27274810):38. 

Tian, Lei; Ding, Sheng; You, Yun; Li, Tong-ruei; Liu, Yan; Wu, Xiaohui; Sun, Ling; Xu, Tian. Leiomodin-3-deficient mice display nemaline myopathy with fast-myofiber atrophy. Disease Models & Mechanisms. 2015;8(6):635-41.