Anti LMO7 pAb (ATL-HPA020923 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA020923-25

Protein Description: LIM domain 7
Gene Name: LMO7
Alternative Gene Name: FBX20, FBXO20, KIAA0858
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033060: 81%, ENSRNOG00000060775: 83%
Entrez Gene ID: 4008
Uniprot ID: Q8WWI1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KIYGENGSKSMSDVSAEDVQNLRQLRYEEMQKIKSQLKEQDQKWQDDLAKWKDRRKSYTSDLQKKKEEREEIEKQALEKSKRSSKTFKEMLQDRESQNQKSTVPSRRRMYSFDDVLEEGKRPPTMTVSEASYQSERVEEKGATY
• Gene Sequence: KIYGENGSKSMSDVSAEDVQNLRQLRYEEMQKIKSQLKEQDQKWQDDLAKWKDRRKSYTSDLQKKKEEREEIEKQALEKSKRSSKTFKEMLQDRESQNQKSTVPSRRRMYSFDDVLEEGKRPPTMTVSEASYQSERVEEKGATY
• Gene ID - Mouse: ENSMUSG00000033060
• Gene ID - Rat: ENSRNOG00000060775
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LMO7 pAb (ATL-HPA020923 w/enhanced validation) – 6 Found

Zhang, Lu; Qiang, PengFei; Yu, JingTing; Miao, YiMing; Chen, ZhiQiang; Qu, Ju; Zhao, QianBing; Chen, Zhuo; Liu, Yachao; Yao, Xin; Liu, Bin; Cui, LiuQing; Jing, HongJuan; Sun, Gangchun. Identification of compound CA-5f as a novel late-stage autophagy inhibitor with potent anti-tumor effect against non-small cell lung cancer. Autophagy. 2019;15(3):391-406. 

Du, Ting-Ting; Dewey, James B; Wagner, Elizabeth L; Cui, Runjia; Heo, Jinho; Park, Jeong-Jin; Francis, Shimon P; Perez-Reyes, Edward; Guillot, Stacey J; Sherman, Nicholas E; Xu, Wenhao; Oghalai, John S; Kachar, Bechara; Shin, Jung-Bum. LMO7 deficiency reveals the significance of the cuticular plate for hearing function. Nature Communications. 2019;10(1):1117. 

Stefansson, Kristina; Oda, Husam; Öfverman, Charlotte; Lundin, Eva; Hedman, Håkan; Lindquist, David. LRIG1‑2 and LMO7 immunoreactivity in vulvar squamous cell carcinoma: Association with prognosis in relation to HPV‑DNA and p16INK4a status. Oncology Reports. 2019;42(1):142-150. 

Gomes, Geyse; do Amaral, Mariana Juliani; Bagri, Kayo Moreira; Vasconcellos, Larissa Melo; Almeida, Marcius da Silva; Alvares, Lúcia Elvira; Mermelstein, Claudia. New Findings on LMO7 Transcripts, Proteins and Regulatory Regions in Human and Vertebrate Model Organisms and the Intracellular Distribution in Skeletal Muscle Cells. International Journal Of Molecular Sciences. 2021;22(23) 

Li, Amy; Ponten, Fredrik; dos Remedios, Cristobal G. The interactome of LIM domain proteins: the contributions of LIM domain proteins to heart failure and heart development. Proteomics. 2012;12(2):203-25. 

Wozniak, Michele A; Baker, Brendon M; Chen, Christopher S; Wilson, Katherine L. The emerin-binding transcription factor Lmo7 is regulated by association with p130Cas at focal adhesions. Peerj. 1( 24010014):e134.