Anti LMBR1 pAb (ATL-HPA016592)
Atlas Antibodies
- Catalog No.:
- ATL-HPA016592-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: LMBR1
Alternative Gene Name: ACHP, C7orf2, FLJ11665, ZRS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010721: 93%, ENSRNOG00000059589: 93%
Entrez Gene ID: 64327
Uniprot ID: Q8WVP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FTVMGQLLVKPTILEDLDEQIYIITLEEEALQRRLNGLSSSVEYNIMELEQELENVKTLKTKLERRKKASAWERN |
| Gene Sequence | FTVMGQLLVKPTILEDLDEQIYIITLEEEALQRRLNGLSSSVEYNIMELEQELENVKTLKTKLERRKKASAWERN |
| Gene ID - Mouse | ENSMUSG00000010721 |
| Gene ID - Rat | ENSRNOG00000059589 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LMBR1 pAb (ATL-HPA016592) | |
| Datasheet | Anti LMBR1 pAb (ATL-HPA016592) Datasheet (External Link) |
| Vendor Page | Anti LMBR1 pAb (ATL-HPA016592) at Atlas Antibodies |
| Documents & Links for Anti LMBR1 pAb (ATL-HPA016592) | |
| Datasheet | Anti LMBR1 pAb (ATL-HPA016592) Datasheet (External Link) |
| Vendor Page | Anti LMBR1 pAb (ATL-HPA016592) |