Anti LMBR1 pAb (ATL-HPA016592)

Atlas Antibodies

Catalog No.: ATL-HPA016592-25

Protein Description: limb development membrane protein 1
Gene Name: LMBR1
Alternative Gene Name: ACHP, C7orf2, FLJ11665, ZRS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010721: 93%, ENSRNOG00000059589: 93%
Entrez Gene ID: 64327
Uniprot ID: Q8WVP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FTVMGQLLVKPTILEDLDEQIYIITLEEEALQRRLNGLSSSVEYNIMELEQELENVKTLKTKLERRKKASAWERN
• Gene Sequence: FTVMGQLLVKPTILEDLDEQIYIITLEEEALQRRLNGLSSSVEYNIMELEQELENVKTLKTKLERRKKASAWERN
• Gene ID - Mouse: ENSMUSG00000010721
• Gene ID - Rat: ENSRNOG00000059589
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.