Anti LIN9 pAb (ATL-HPA030241)

Atlas Antibodies

Catalog No.: ATL-HPA030241-25

Protein Description: lin-9 DREAM MuvB core complex component
Gene Name: LIN9
Alternative Gene Name: TGS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058729: 96%, ENSRNOG00000023304: 96%
Entrez Gene ID: 286826
Uniprot ID: Q5TKA1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRHANSSTGQPCVENENLTDLISRLTAILLQIKCLA
• Gene Sequence: LNKDLNKVLHKVQQYCYELAPDQGLQPADQPTDMRRRCEEEAQEIVRHANSSTGQPCVENENLTDLISRLTAILLQIKCLA
• Gene ID - Mouse: ENSMUSG00000058729
• Gene ID - Rat: ENSRNOG00000023304
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.