Anti LIN52 pAb (ATL-HPA001777)

Atlas Antibodies

Catalog No.: ATL-HPA001777-25

Protein Description: lin-52 DREAM MuvB core complex component
Gene Name: LIN52
Alternative Gene Name: C14orf46
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000085793: 100%, ENSRNOG00000043441: 85%
Entrez Gene ID: 91750
Uniprot ID: Q52LA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GWKMASPTDGTDLEASLLSFEKLDRASPDLWPEQLPGVAEFAASFKSPITSSPPKWMAEIERDDIDMLKELGSLTTANLMEKVRGLQNLAYQLGLDESREMTRGKFLNILEKP
• Gene Sequence: GWKMASPTDGTDLEASLLSFEKLDRASPDLWPEQLPGVAEFAASFKSPITSSPPKWMAEIERDDIDMLKELGSLTTANLMEKVRGLQNLAYQLGLDESREMTRGKFLNILEKP
• Gene ID - Mouse: ENSMUSG00000085793
• Gene ID - Rat: ENSRNOG00000043441
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.