Anti LIMK1 pAb (ATL-HPA028516)

Atlas Antibodies

Catalog No.: ATL-HPA028516-25

Protein Description: LIM domain kinase 1
Gene Name: LIMK1
Alternative Gene Name: LIMK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029674: 98%, ENSRNOG00000001470: 97%
Entrez Gene ID: 3984
Uniprot ID: P53667
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EHSKLYCGHCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHV
• Gene Sequence: EHSKLYCGHCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHV
• Gene ID - Mouse: ENSMUSG00000029674
• Gene ID - Rat: ENSRNOG00000001470
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LIMK1 pAb (ATL-HPA028516) – 3 Found

Ito, Shoko; Okuda, Satoru; Abe, Masako; Fujimoto, Mari; Onuki, Tetsuo; Nishimura, Tamako; Takeichi, Masatoshi. Induced cortical tension restores functional junctions in adhesion-defective carcinoma cells. Nature Communications. 2017;8(1):1834. 

Li, Amy; Ponten, Fredrik; dos Remedios, Cristobal G. The interactome of LIM domain proteins: the contributions of LIM domain proteins to heart failure and heart development. Proteomics. 2012;12(2):203-25. 

Park, Jun-Bum; Agnihotri, Sameer; Golbourn, Brian; Bertrand, Kelsey C; Luck, Amanda; Sabha, Nesrin; Smith, Christian A; Byron, Sara; Zadeh, Gelareh; Croul, Sidney; Berens, Michael; Rutka, James T. Transcriptional profiling of GBM invasion genes identifies effective inhibitors of the LIM kinase-Cofilin pathway. Oncotarget. 2014;5(19):9382-95.