Anti LIG4 pAb (ATL-HPA001334)

Atlas Antibodies

Catalog No.:
ATL-HPA001334-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: ligase IV, DNA, ATP-dependent
Gene Name: LIG4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049717: 83%, ENSRNOG00000014605: 82%
Entrez Gene ID: 3981
Uniprot ID: P49917
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TYCVIAGSENIRVKNIILSNKHDVVKPAWLLECFKTKSFVPWQPRFMIHMCPSTKEHFAREYDCYGDSYFIDTDLNQLKEVFSGIKNSNEQTPEEMASLIADLEYRYSWDCSPLSMFRRHTVYLDSYA
Gene Sequence TYCVIAGSENIRVKNIILSNKHDVVKPAWLLECFKTKSFVPWQPRFMIHMCPSTKEHFAREYDCYGDSYFIDTDLNQLKEVFSGIKNSNEQTPEEMASLIADLEYRYSWDCSPLSMFRRHTVYLDSYA
Gene ID - Mouse ENSMUSG00000049717
Gene ID - Rat ENSRNOG00000014605
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LIG4 pAb (ATL-HPA001334)
Datasheet Anti LIG4 pAb (ATL-HPA001334) Datasheet (External Link)
Vendor Page Anti LIG4 pAb (ATL-HPA001334) at Atlas Antibodies

Documents & Links for Anti LIG4 pAb (ATL-HPA001334)
Datasheet Anti LIG4 pAb (ATL-HPA001334) Datasheet (External Link)
Vendor Page Anti LIG4 pAb (ATL-HPA001334)
Citations for Anti LIG4 pAb (ATL-HPA001334) – 4 Found
Sousa, Mirta M L; Zub, Kamila Anna; Aas, Per Arne; Hanssen-Bauer, Audun; Demirovic, Aida; Sarno, Antonio; Tian, Erming; Liabakk, Nina B; Slupphaug, Geir. An inverse switch in DNA base excision and strand break repair contributes to melphalan resistance in multiple myeloma cells. Plos One. 8(2):e55493.  PubMed
Jun, Sohee; Jung, Youn-Sang; Suh, Han Na; Wang, Wenqi; Kim, Moon Jong; Oh, Young Sun; Lien, Esther M; Shen, Xi; Matsumoto, Yoshihisa; McCrea, Pierre D; Li, Lei; Chen, Junjie; Park, Jae-Il. LIG4 mediates Wnt signalling-induced radioresistance. Nature Communications. 2016;7( 27009971):10994.  PubMed
Mladenov, Emil; Staudt, Christian; Soni, Aashish; Murmann-Konda, Tamara; Siemann-Loekes, Maria; Iliakis, George. Strong suppression of gene conversion with increasing DNA double-strand break load delimited by 53BP1 and RAD52. Nucleic Acids Research. 2020;48(4):1905-1924.  PubMed
Eki, Rebeka; She, Jane; Parlak, Mahmut; Benamar, Mouadh; Du, Kang-Ping; Kumar, Pankaj; Abbas, Tarek. A robust CRISPR-Cas9-based fluorescent reporter assay for the detection and quantification of DNA double-strand break repair. Nucleic Acids Research. 2020;48(21):e126.  PubMed