Anti LIF pAb (ATL-HPA018844)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018844-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: LIF
Alternative Gene Name: CDF, DIA, HILDA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034394: 88%, ENSRNOG00000007002: 91%
Entrez Gene ID: 3976
Uniprot ID: P15018
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEK |
| Gene Sequence | MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEK |
| Gene ID - Mouse | ENSMUSG00000034394 |
| Gene ID - Rat | ENSRNOG00000007002 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LIF pAb (ATL-HPA018844) | |
| Datasheet | Anti LIF pAb (ATL-HPA018844) Datasheet (External Link) |
| Vendor Page | Anti LIF pAb (ATL-HPA018844) at Atlas Antibodies |
| Documents & Links for Anti LIF pAb (ATL-HPA018844) | |
| Datasheet | Anti LIF pAb (ATL-HPA018844) Datasheet (External Link) |
| Vendor Page | Anti LIF pAb (ATL-HPA018844) |
| Citations for Anti LIF pAb (ATL-HPA018844) – 2 Found |
| Pascual-García, Mónica; Bonfill-Teixidor, Ester; Planas-Rigol, Ester; Rubio-Perez, Carlota; Iurlaro, Raffaella; Arias, Alexandra; Cuartas, Isabel; Sala-Hojman, Ada; Escudero, Laura; Martínez-Ricarte, Francisco; Huber-Ruano, Isabel; Nuciforo, Paolo; Pedrosa, Leire; Marques, Carolina; Braña, Irene; Garralda, Elena; Vieito, María; Squatrito, Massimo; Pineda, Estela; Graus, Francesc; Espejo, Carmen; Sahuquillo, Juan; Tabernero, Josep; Seoane, Joan. LIF regulates CXCL9 in tumor-associated macrophages and prevents CD8(+) T cell tumor-infiltration impairing anti-PD1 therapy. Nature Communications. 2019;10(1):2416. PubMed |
| Itoh, Go; Takagane, Kurara; Fukushi, Yuma; Kuriyama, Sei; Umakoshi, Michinobu; Goto, Akiteru; Yanagihara, Kazuyoshi; Yashiro, Masakazu; Tanaka, Masamitsu. Cancer-associated fibroblasts educate normal fibroblasts to facilitate cancer cell spreading and T-cell suppression. Molecular Oncology. 2022;16(1):166-187. PubMed |