Anti LIAS pAb (ATL-HPA018842)

Atlas Antibodies

Catalog No.: ATL-HPA018842-25

Protein Description: lipoic acid synthetase
Gene Name: LIAS
Alternative Gene Name: LAS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029199: 89%, ENSRNOG00000002759: 92%
Entrez Gene ID: 11019
Uniprot ID: O43766
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SKVRDPRANFDQSLRVLKHAKKVQPDVISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYMQPTRRHLK
• Gene Sequence: SKVRDPRANFDQSLRVLKHAKKVQPDVISKTSIMLGLGENDEQVYATMKALREADVDCLTLGQYMQPTRRHLK
• Gene ID - Mouse: ENSMUSG00000029199
• Gene ID - Rat: ENSRNOG00000002759
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.