Anti LGSN pAb (ATL-HPA039983 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA039983-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: lengsin, lens protein with glutamine synthetase domain
Gene Name: LGSN
Alternative Gene Name: GLULD1, LGS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050217: 90%, ENSRNOG00000012205: 90%
Entrez Gene ID: 51557
Uniprot ID: Q5TDP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VSRSKTIPAHFFQEKVSHGVCMPRGYLEVIPNPKDNEMNNIRATCFNSDIVLMPELSTFRVLPWADRTARVICDTFTVTGEPLLTSPRY
Gene Sequence VSRSKTIPAHFFQEKVSHGVCMPRGYLEVIPNPKDNEMNNIRATCFNSDIVLMPELSTFRVLPWADRTARVICDTFTVTGEPLLTSPRY
Gene ID - Mouse ENSMUSG00000050217
Gene ID - Rat ENSRNOG00000012205
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LGSN pAb (ATL-HPA039983 w/enhanced validation)
Datasheet Anti LGSN pAb (ATL-HPA039983 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LGSN pAb (ATL-HPA039983 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti LGSN pAb (ATL-HPA039983 w/enhanced validation)
Datasheet Anti LGSN pAb (ATL-HPA039983 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti LGSN pAb (ATL-HPA039983 w/enhanced validation)