Anti LGI4 pAb (ATL-HPA042116)

Atlas Antibodies

Catalog No.: ATL-HPA042116-25

Protein Description: leucine-rich repeat LGI family, member 4
Gene Name: LGI4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036560: 86%, ENSRNOG00000021087: 84%
Entrez Gene ID: 163175
Uniprot ID: Q8N135
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DTLTHVDLRGNPFQCDCRVLWLLQWMPTVNASVGTGACAGPASLSHMQLHHLDPKTFKCRAIELSWFQTVGESALSV
• Gene Sequence: DTLTHVDLRGNPFQCDCRVLWLLQWMPTVNASVGTGACAGPASLSHMQLHHLDPKTFKCRAIELSWFQTVGESALSV
• Gene ID - Mouse: ENSMUSG00000036560
• Gene ID - Rat: ENSRNOG00000021087
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.