Anti LGALS7 pAb (ATL-HPA001549)

Atlas Antibodies

Catalog No.: ATL-HPA001549-100

Protein Description: lectin, galactoside-binding, soluble, 7
Gene Name: LGALS7
Alternative Gene Name: GAL7, LGALS7A, PIG1, TP53I1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053522: 79%, ENSRNOG00000020380: 74%
Entrez Gene ID: 3963
Uniprot ID: P47929
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSV
• Gene Sequence: PHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSV
• Gene ID - Mouse: ENSMUSG00000053522
• Gene ID - Rat: ENSRNOG00000020380
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LGALS7 pAb (ATL-HPA001549) – 1 Found

Higareda-Almaraz, Juan Carlos; Ruiz-Moreno, Juan S; Klimentova, Jana; Barbieri, Daniela; Salvador-Gallego, Raquel; Ly, Regina; Valtierra-Gutierrez, Ilse A; Dinsart, Christiane; Rabinovich, Gabriel A; Stulik, Jiri; Rösl, Frank; Rincon-Orozco, Bladimiro. Systems-level effects of ectopic galectin-7 reconstitution in cervical cancer and its microenvironment. Bmc Cancer. 2016;16(1):680.