Anti LGALS3BP pAb (ATL-HPA000554 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA000554-100

Protein Description: lectin, galactoside-binding, soluble, 3 binding protein
Gene Name: LGALS3BP
Alternative Gene Name: 90K, BTBD17B, CyCAP, gp90, M2BP, MAC-2-BP, TANGO10B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033880: 67%, ENSRNOG00000003217: 66%
Entrez Gene ID: 3959
Uniprot ID: Q08380
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RHERDAGVVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITLSSVKCFHKLAS
• Gene Sequence: RHERDAGVVCTNETRSTHTLDLSRELSEALGQIFDSQRGCDLSISVNVQGEDALGFCGHTVILTANLEAQALWKEPGSNVTMSVDAECVPMVRDLLRYFYSRRIDITLSSVKCFHKLAS
• Gene ID - Mouse: ENSMUSG00000033880
• Gene ID - Rat: ENSRNOG00000003217
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LGALS3BP pAb (ATL-HPA000554 w/enhanced validation) – 2 Found

Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81. 

Block, Ashley S; Saraswati, Sarika; Lichti, Cheryl F; Mahadevan, Maha; Diekman, Alan B. Co-purification of Mac-2 binding protein with galectin-3 and association with prostasomes in human semen. The Prostate. 2011;71(7):711-21.