Anti LETM1 pAb (ATL-HPA011100 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA011100-25

Protein Description: leucine zipper-EF-hand containing transmembrane protein 1
Gene Name: LETM1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005299: 56%, ENSRNOG00000016427: 53%
Entrez Gene ID: 3954
Uniprot ID: O95202
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: STLGLRNCLNVPFGCCTPIHPVYTSSRGDHLGCWALRPECLRIVSRAPWTSTSVGFVAVGPQCLPVRGWHSSRPVRDDSVVEKSLKSL
• Gene Sequence: STLGLRNCLNVPFGCCTPIHPVYTSSRGDHLGCWALRPECLRIVSRAPWTSTSVGFVAVGPQCLPVRGWHSSRPVRDDSVVEKSLKSL
• Gene ID - Mouse: ENSMUSG00000005299
• Gene ID - Rat: ENSRNOG00000016427
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.