Anti LEO1 pAb (ATL-HPA040941)

Atlas Antibodies

Catalog No.: ATL-HPA040941-25

Protein Description: Leo1, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae)
Gene Name: LEO1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042487: 85%, ENSRNOG00000010116: 82%
Entrez Gene ID: 123169
Uniprot ID: Q8WVC0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DEERAQGSDEDKLQNSDDDEKMQNTGDEERPQLSDDERQQLSEEEKANSDDERPVASDNDDEKQNSDDEGQPQLSDEEKMQNSDDER
• Gene Sequence: DEERAQGSDEDKLQNSDDDEKMQNTGDEERPQLSDDERQQLSEEEKANSDDERPVASDNDDEKQNSDDEGQPQLSDEEKMQNSDDER
• Gene ID - Mouse: ENSMUSG00000042487
• Gene ID - Rat: ENSRNOG00000010116
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.