Anti LEMD2 pAb (ATL-HPA017340)

Atlas Antibodies

Catalog No.: ATL-HPA017340-25

Protein Description: LEM domain containing 2
Gene Name: LEMD2
Alternative Gene Name: dJ482C21.1, NET25
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044857: 92%, ENSRNOG00000025864: 90%
Entrez Gene ID: 221496
Uniprot ID: Q8NC56
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EDNMKLLPVDCERKTDEFCQAKQKAALLELLHELYNFLAIQAGNFECGNPENLKSKCIPVMEAQEYIANVTSSSSAKFEAALTWILSSNKDVGIWLKGEDQSELVTTVDKVVCLESAHP
• Gene Sequence: EDNMKLLPVDCERKTDEFCQAKQKAALLELLHELYNFLAIQAGNFECGNPENLKSKCIPVMEAQEYIANVTSSSSAKFEAALTWILSSNKDVGIWLKGEDQSELVTTVDKVVCLESAHP
• Gene ID - Mouse: ENSMUSG00000044857
• Gene ID - Rat: ENSRNOG00000025864
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LEMD2 pAb (ATL-HPA017340) – 10 Found

Gu, Mingyu; LaJoie, Dollie; Chen, Opal S; von Appen, Alexander; Ladinsky, Mark S; Redd, Michael J; Nikolova, Linda; Bjorkman, Pamela J; Sundquist, Wesley I; Ullman, Katharine S; Frost, Adam. LEM2 recruits CHMP7 for ESCRT-mediated nuclear envelope closure in fission yeast and human cells. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2017;114(11):E2166-E2175. 

Suzuki, Yuka; Bilir, Şükriye; Hatano, Yu; Fukuda, Tatsuhito; Mashiko, Daisuke; Kobayashi, Shouhei; Hiraoka, Yasushi; Haraguchi, Tokuko; Yamagata, Kazuo. Nuclear formation induced by DNA-conjugated beads in living fertilised mouse egg. Scientific Reports. 2019;9(1):8461. 

Gatta, Alberto T; Olmos, Yolanda; Stoten, Caroline L; Chen, Qu; Rosenthal, Peter B; Carlton, Jeremy G. CDK1 controls CHMP7-dependent nuclear envelope reformation. Elife. 2021;10( 34286694) 

Sears, Rhiannon M; Roux, Kyle J. Mechanisms of A-Type Lamin Targeting to Nuclear Ruptures Are Disrupted in LMNA- and BANF1-Associated Progerias. Cells. 2022;11(5) 

Halfmann, Charles T; Sears, Rhiannon M; Katiyar, Aditya; Busselman, Brook W; Aman, London K; Zhang, Qiao; O'Bryan, Christopher S; Angelini, Thomas E; Lele, Tanmay P; Roux, Kyle J. Repair of nuclear ruptures requires barrier-to-autointegration factor. The Journal Of Cell Biology. 2019;218(7):2136-2149. 

Young, Alexandra M; Gunn, Amanda L; Hatch, Emily M. BAF facilitates interphase nuclear membrane repair through recruitment of nuclear transmembrane proteins. Molecular Biology Of The Cell. 2020;31(15):1551-1560. 

von Appen, Alexander; LaJoie, Dollie; Johnson, Isabel E; Trnka, Michael J; Pick, Sarah M; Burlingame, Alma L; Ullman, Katharine S; Frost, Adam. LEM2 phase separation promotes ESCRT-mediated nuclear envelope reformation. Nature. 2020;582(7810):115-118. 

Feurle, Patrick; Abentung, Andreas; Cera, Isabella; Wahl, Nico; Ablinger, Cornelia; Bucher, Michael; Stefan, Eduard; Sprenger, Simon; Teis, David; Fischer, Andre; Laighneach, Aodán; Whitton, Laura; Morris, Derek W; Apostolova, Galina; Dechant, Georg. SATB2-LEMD2 interaction links nuclear shape plasticity to regulation of cognition-related genes. The Embo Journal. 2021;40(3):e103701. 

Ramirez-Martinez, Andres; Zhang, Yichi; Chen, Kenian; Kim, Jiwoong; Cenik, Bercin K; McAnally, John R; Cai, Chunyu; Shelton, John M; Huang, Jian; Brennan, Ana; Evers, Bret M; Mammen, Pradeep P A; Xu, Lin; Bassel-Duby, Rhonda; Liu, Ning; Olson, Eric N. The nuclear envelope protein Net39 is essential for muscle nuclear integrity and chromatin organization. Nature Communications. 2021;12(1):690. 

Caravia, Xurde M; Ramirez-Martinez, Andres; Gan, Peiheng; Wang, Feng; McAnally, John R; Xu, Lin; Bassel-Duby, Rhonda; Liu, Ning; Olson, Eric N. Loss of function of the nuclear envelope protein LEMD2 causes DNA damage-dependent cardiomyopathy. The Journal Of Clinical Investigation. 2022;132(22)