Anti LDAH pAb (ATL-HPA034730)

Atlas Antibodies

Catalog No.: ATL-HPA034730-25

Protein Description: lipid droplet associated hydrolase
Gene Name: LDAH
Alternative Gene Name: C2orf43, FLJ21820
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037669: 79%, ENSRNOG00000021475: 75%
Entrez Gene ID: 60526
Uniprot ID: Q9H6V9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SNAQEIKDIYGLNGQIEHKLAFLRTHVPKDMKLVLIGHSIGSYFTLQMLKRVPELPVIRAFLLFPTIERMSESPNGR
• Gene Sequence: SNAQEIKDIYGLNGQIEHKLAFLRTHVPKDMKLVLIGHSIGSYFTLQMLKRVPELPVIRAFLLFPTIERMSESPNGR
• Gene ID - Mouse: ENSMUSG00000037669
• Gene ID - Rat: ENSRNOG00000021475
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LDAH pAb (ATL-HPA034730) – 1 Found

Currall, Benjamin B; Chen, Ming; Sallari, Richard C; Cotter, Maura; Wong, Kristen E; Robertson, Nahid G; Penney, Kathryn L; Lunardi, Andrea; Reschke, Markus; Hickox, Ann E; Yin, Yanbo; Wong, Garrett T; Fung, Jacqueline; Brown, Kerry K; Williamson, Robin E; Sinnott-Armstrong, Nicholas A; Kammin, Tammy; Ivanov, Andrew; Zepeda-Mendoza, Cinthya J; Shen, Jun; Quade, Bradley J; Signoretti, Sabina; Arnos, Kathleen S; Banks, Alexander S; Patsopoulos, Nikolaos; Liberman, M Charles; Kellis, Manolis; Pandolfi, Pier Paolo; Morton, Cynthia C. Loss of LDAH associated with prostate cancer and hearing loss. Human Molecular Genetics. 2018;27(24):4194-4203.