Anti LDAH pAb (ATL-HPA034729)
Atlas Antibodies
- Catalog No.:
- ATL-HPA034729-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: LDAH
Alternative Gene Name: C2orf43, FLJ21820
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037669: 62%, ENSRNOG00000021475: 62%
Entrez Gene ID: 60526
Uniprot ID: Q9H6V9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PETIKSLLIRRGLQVMNLENEFSPLNILEPFCLANAAYLGGQEMMEVVKRDDETIKEHLCKLTFYYGTIDPWCPKEYYEDIKKDFPE |
| Gene Sequence | PETIKSLLIRRGLQVMNLENEFSPLNILEPFCLANAAYLGGQEMMEVVKRDDETIKEHLCKLTFYYGTIDPWCPKEYYEDIKKDFPE |
| Gene ID - Mouse | ENSMUSG00000037669 |
| Gene ID - Rat | ENSRNOG00000021475 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LDAH pAb (ATL-HPA034729) | |
| Datasheet | Anti LDAH pAb (ATL-HPA034729) Datasheet (External Link) |
| Vendor Page | Anti LDAH pAb (ATL-HPA034729) at Atlas Antibodies |
| Documents & Links for Anti LDAH pAb (ATL-HPA034729) | |
| Datasheet | Anti LDAH pAb (ATL-HPA034729) Datasheet (External Link) |
| Vendor Page | Anti LDAH pAb (ATL-HPA034729) |