Anti LDAH pAb (ATL-HPA034729)

Atlas Antibodies

Catalog No.: ATL-HPA034729-25

Protein Description: lipid droplet associated hydrolase
Gene Name: LDAH
Alternative Gene Name: C2orf43, FLJ21820
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037669: 62%, ENSRNOG00000021475: 62%
Entrez Gene ID: 60526
Uniprot ID: Q9H6V9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PETIKSLLIRRGLQVMNLENEFSPLNILEPFCLANAAYLGGQEMMEVVKRDDETIKEHLCKLTFYYGTIDPWCPKEYYEDIKKDFPE
• Gene Sequence: PETIKSLLIRRGLQVMNLENEFSPLNILEPFCLANAAYLGGQEMMEVVKRDDETIKEHLCKLTFYYGTIDPWCPKEYYEDIKKDFPE
• Gene ID - Mouse: ENSMUSG00000037669
• Gene ID - Rat: ENSRNOG00000021475
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.