Anti LCMT1 pAb (ATL-HPA041559)

Atlas Antibodies

Catalog No.:
ATL-HPA041559-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: leucine carboxyl methyltransferase 1
Gene Name: LCMT1
Alternative Gene Name: CGI-68, PPMT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030763: 89%, ENSRNOG00000014565: 89%
Entrez Gene ID: 51451
Uniprot ID: Q9UIC8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen RLLSNGWETASAVDMMELYNRLPRAEVSRIESLEFLDEMELLEQLMRHYCLCWATKGGNELGLKE
Gene Sequence RLLSNGWETASAVDMMELYNRLPRAEVSRIESLEFLDEMELLEQLMRHYCLCWATKGGNELGLKE
Gene ID - Mouse ENSMUSG00000030763
Gene ID - Rat ENSRNOG00000014565
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LCMT1 pAb (ATL-HPA041559)
Datasheet Anti LCMT1 pAb (ATL-HPA041559) Datasheet (External Link)
Vendor Page Anti LCMT1 pAb (ATL-HPA041559) at Atlas Antibodies

Documents & Links for Anti LCMT1 pAb (ATL-HPA041559)
Datasheet Anti LCMT1 pAb (ATL-HPA041559) Datasheet (External Link)
Vendor Page Anti LCMT1 pAb (ATL-HPA041559)