Anti LCLAT1 pAb (ATL-HPA031880)

Atlas Antibodies

Catalog No.:
ATL-HPA031880-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: lysocardiolipin acyltransferase 1
Gene Name: LCLAT1
Alternative Gene Name: AGPAT8, ALCAT1, FLJ37965, LYCAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054469: 90%, ENSRNOG00000034026: 91%
Entrez Gene ID: 253558
Uniprot ID: Q6UWP7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LHPRTTGFTFVVDRLREGKNLDAVHDITVAYPHNIPQSEKHLLQGDFPREIHFHVHRYPIDTLPTSKEDLQLWCHKR
Gene Sequence LHPRTTGFTFVVDRLREGKNLDAVHDITVAYPHNIPQSEKHLLQGDFPREIHFHVHRYPIDTLPTSKEDLQLWCHKR
Gene ID - Mouse ENSMUSG00000054469
Gene ID - Rat ENSRNOG00000034026
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LCLAT1 pAb (ATL-HPA031880)
Datasheet Anti LCLAT1 pAb (ATL-HPA031880) Datasheet (External Link)
Vendor Page Anti LCLAT1 pAb (ATL-HPA031880) at Atlas Antibodies

Documents & Links for Anti LCLAT1 pAb (ATL-HPA031880)
Datasheet Anti LCLAT1 pAb (ATL-HPA031880) Datasheet (External Link)
Vendor Page Anti LCLAT1 pAb (ATL-HPA031880)