Anti LCA5L pAb (ATL-HPA032010 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA032010-25

Protein Description: Leber congenital amaurosis 5-like
Gene Name: LCA5L
Alternative Gene Name: C21orf13, MGC33295
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045275: 55%, ENSRNOG00000028248: 54%
Entrez Gene ID: 150082
Uniprot ID: O95447
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ILPFTSMRHQGTQKSDVPPLTTKGKKATGNIDHKEKSTEINHEIPHCVNKLPKQEDSKRKYEDLSGEEKHLEVQILLENT
• Gene Sequence: ILPFTSMRHQGTQKSDVPPLTTKGKKATGNIDHKEKSTEINHEIPHCVNKLPKQEDSKRKYEDLSGEEKHLEVQILLENT
• Gene ID - Mouse: ENSMUSG00000045275
• Gene ID - Rat: ENSRNOG00000028248
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.