Anti LBX2 pAb (ATL-HPA044257)

Atlas Antibodies

Catalog No.:
ATL-HPA044257-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ladybird homeobox 2
Gene Name: LBX2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034968: 72%, ENSRNOG00000052374: 71%
Entrez Gene ID: 85474
Uniprot ID: Q6XYB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKRDVEEMRADVASLRALSPEVLCSLALPEGAPDPGLCLGPAGPDSRPHLSDEEIQVDD
Gene Sequence LKRDVEEMRADVASLRALSPEVLCSLALPEGAPDPGLCLGPAGPDSRPHLSDEEIQVDD
Gene ID - Mouse ENSMUSG00000034968
Gene ID - Rat ENSRNOG00000052374
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LBX2 pAb (ATL-HPA044257)
Datasheet Anti LBX2 pAb (ATL-HPA044257) Datasheet (External Link)
Vendor Page Anti LBX2 pAb (ATL-HPA044257) at Atlas Antibodies

Documents & Links for Anti LBX2 pAb (ATL-HPA044257)
Datasheet Anti LBX2 pAb (ATL-HPA044257) Datasheet (External Link)
Vendor Page Anti LBX2 pAb (ATL-HPA044257)