Anti LBHD1 pAb (ATL-HPA023592 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA023592-25

Protein Description: LBH domain containing 1
Gene Name: LBHD1
Alternative Gene Name: C11orf48, MGC2477
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000096740: 71%, ENSRNOG00000054514: 30%
Entrez Gene ID: 79081
Uniprot ID: Q9BQE6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SEAPGGRGCDRPRADHAAPPQEAGVQCTCQHYTVREEAQKTPPADPACPEREDSHGSGSPFKASQD
• Gene Sequence: SEAPGGRGCDRPRADHAAPPQEAGVQCTCQHYTVREEAQKTPPADPACPEREDSHGSGSPFKASQD
• Gene ID - Mouse: ENSMUSG00000096740
• Gene ID - Rat: ENSRNOG00000054514
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.