Anti LATS2 pAb (ATL-HPA039191)

Atlas Antibodies

Catalog No.:
ATL-HPA039191-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: large tumor suppressor kinase 2
Gene Name: LATS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021959: 75%, ENSRNOG00000056343: 74%
Entrez Gene ID: 26524
Uniprot ID: Q9NRM7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HLLLRSKSEQYDLDSLCAGMEQSLRAGPNEPEGGDKSRKSAKGDKGGKDKKQIQTSPVPVRKNSRDEEKR
Gene Sequence HLLLRSKSEQYDLDSLCAGMEQSLRAGPNEPEGGDKSRKSAKGDKGGKDKKQIQTSPVPVRKNSRDEEKR
Gene ID - Mouse ENSMUSG00000021959
Gene ID - Rat ENSRNOG00000056343
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LATS2 pAb (ATL-HPA039191)
Datasheet Anti LATS2 pAb (ATL-HPA039191) Datasheet (External Link)
Vendor Page Anti LATS2 pAb (ATL-HPA039191) at Atlas Antibodies

Documents & Links for Anti LATS2 pAb (ATL-HPA039191)
Datasheet Anti LATS2 pAb (ATL-HPA039191) Datasheet (External Link)
Vendor Page Anti LATS2 pAb (ATL-HPA039191)
Citations for Anti LATS2 pAb (ATL-HPA039191) – 1 Found
Ito, Takeshi; Nakamura, Atsuko; Tanaka, Ichidai; Tsuboi, Yumi; Morikawa, Teppei; Nakajima, Jun; Takai, Daiya; Fukayama, Masashi; Sekido, Yoshitaka; Niki, Toshiro; Matsubara, Daisuke; Murakami, Yoshinori. CADM1 associates with Hippo pathway core kinases; membranous co-expression of CADM1 and LATS2 in lung tumors predicts good prognosis. Cancer Science. 2019;110(7):2284-2295.  PubMed