Anti LAT2 pAb (ATL-HPA003462 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA003462-100

Protein Description: linker for activation of T cells family, member 2
Gene Name: LAT2
Alternative Gene Name: HSPC046, LAB, NTAL, WBSCR15, WBSCR5, WSCR5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040751: 46%, ENSRNOG00000021856: 46%
Entrez Gene ID: 7462
Uniprot ID: Q9GZY6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKRSEKIYQQRSLREDQQSFTGSRTYSLVGQAWPGPLADMAPTRKDKLLQFYPSLEDPASSRYQNFSKGSRHGSEEAYIDPIAMEYYNWGRFSKPPEDDDANSYENVLICKQKTTETGAQQEGIGGLCRGDLSLSLALKTGPT
• Gene Sequence: AKRSEKIYQQRSLREDQQSFTGSRTYSLVGQAWPGPLADMAPTRKDKLLQFYPSLEDPASSRYQNFSKGSRHGSEEAYIDPIAMEYYNWGRFSKPPEDDDANSYENVLICKQKTTETGAQQEGIGGLCRGDLSLSLALKTGPT
• Gene ID - Mouse: ENSMUSG00000040751
• Gene ID - Rat: ENSRNOG00000021856
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.