Anti LARS2 pAb (ATL-HPA035951)

Atlas Antibodies

Catalog No.:
ATL-HPA035951-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: leucyl-tRNA synthetase 2, mitochondrial
Gene Name: LARS2
Alternative Gene Name: KIAA0028, LEURS, MGC26121
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035202: 87%, ENSRNOG00000004760: 86%
Entrez Gene ID: 23395
Uniprot ID: Q15031
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSGQYLQREEVDLTGSVPVHAKTKEKLEVTWEKMSKSKHNGVDPEEVVEQYGIDTIRLYILFAAPPEKDILWDVKTDALPGVLRWQQRLWT
Gene Sequence PSGQYLQREEVDLTGSVPVHAKTKEKLEVTWEKMSKSKHNGVDPEEVVEQYGIDTIRLYILFAAPPEKDILWDVKTDALPGVLRWQQRLWT
Gene ID - Mouse ENSMUSG00000035202
Gene ID - Rat ENSRNOG00000004760
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LARS2 pAb (ATL-HPA035951)
Datasheet Anti LARS2 pAb (ATL-HPA035951) Datasheet (External Link)
Vendor Page Anti LARS2 pAb (ATL-HPA035951) at Atlas Antibodies

Documents & Links for Anti LARS2 pAb (ATL-HPA035951)
Datasheet Anti LARS2 pAb (ATL-HPA035951) Datasheet (External Link)
Vendor Page Anti LARS2 pAb (ATL-HPA035951)
Citations for Anti LARS2 pAb (ATL-HPA035951) – 1 Found
Perli, Elena; Giordano, Carla; Pisano, Annalinda; Montanari, Arianna; Campese, Antonio F; Reyes, Aurelio; Ghezzi, Daniele; Nasca, Alessia; Tuppen, Helen A; Orlandi, Maurizia; Di Micco, Patrizio; Poser, Elena; Taylor, Robert W; Colotti, Gianni; Francisci, Silvia; Morea, Veronica; Frontali, Laura; Zeviani, Massimo; d'Amati, Giulia. The isolated carboxy-terminal domain of human mitochondrial leucyl-tRNA synthetase rescues the pathological phenotype of mitochondrial tRNA mutations in human cells. Embo Molecular Medicine. 2014;6(2):169-82.  PubMed