Anti LARS2 pAb (ATL-HPA035951)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035951-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: LARS2
Alternative Gene Name: KIAA0028, LEURS, MGC26121
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035202: 87%, ENSRNOG00000004760: 86%
Entrez Gene ID: 23395
Uniprot ID: Q15031
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PSGQYLQREEVDLTGSVPVHAKTKEKLEVTWEKMSKSKHNGVDPEEVVEQYGIDTIRLYILFAAPPEKDILWDVKTDALPGVLRWQQRLWT |
| Gene Sequence | PSGQYLQREEVDLTGSVPVHAKTKEKLEVTWEKMSKSKHNGVDPEEVVEQYGIDTIRLYILFAAPPEKDILWDVKTDALPGVLRWQQRLWT |
| Gene ID - Mouse | ENSMUSG00000035202 |
| Gene ID - Rat | ENSRNOG00000004760 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LARS2 pAb (ATL-HPA035951) | |
| Datasheet | Anti LARS2 pAb (ATL-HPA035951) Datasheet (External Link) |
| Vendor Page | Anti LARS2 pAb (ATL-HPA035951) at Atlas Antibodies |
| Documents & Links for Anti LARS2 pAb (ATL-HPA035951) | |
| Datasheet | Anti LARS2 pAb (ATL-HPA035951) Datasheet (External Link) |
| Vendor Page | Anti LARS2 pAb (ATL-HPA035951) |
| Citations for Anti LARS2 pAb (ATL-HPA035951) – 1 Found |
| Perli, Elena; Giordano, Carla; Pisano, Annalinda; Montanari, Arianna; Campese, Antonio F; Reyes, Aurelio; Ghezzi, Daniele; Nasca, Alessia; Tuppen, Helen A; Orlandi, Maurizia; Di Micco, Patrizio; Poser, Elena; Taylor, Robert W; Colotti, Gianni; Francisci, Silvia; Morea, Veronica; Frontali, Laura; Zeviani, Massimo; d'Amati, Giulia. The isolated carboxy-terminal domain of human mitochondrial leucyl-tRNA synthetase rescues the pathological phenotype of mitochondrial tRNA mutations in human cells. Embo Molecular Medicine. 2014;6(2):169-82. PubMed |