Anti LAGE3 pAb (ATL-HPA036122)

Atlas Antibodies

Catalog No.: ATL-HPA036122-25

Protein Description: L antigen family, member 3
Gene Name: LAGE3
Alternative Gene Name: CVG5, DXS9879E, DXS9951E, ESO3, ITBA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015289: 71%, ENSRNOG00000053456: 71%
Entrez Gene ID: 8270
Uniprot ID: Q14657
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IFTLSVPFPTPLEAEIAHGSLAPDAEPHQRVVGKDLTVSGRILVVRWKAEDCRLLRISVINFLDQLSLVVRTMQRFG
• Gene Sequence: IFTLSVPFPTPLEAEIAHGSLAPDAEPHQRVVGKDLTVSGRILVVRWKAEDCRLLRISVINFLDQLSLVVRTMQRFG
• Gene ID - Mouse: ENSMUSG00000015289
• Gene ID - Rat: ENSRNOG00000053456
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LAGE3 pAb (ATL-HPA036122) – 2 Found

Arrondel, Christelle; Missoury, Sophia; Snoek, Rozemarijn; Patat, Julie; Menara, Giulia; Collinet, Bruno; Liger, Dominique; Durand, Dominique; Gribouval, Olivier; Boyer, Olivia; Buscara, Laurine; Martin, Gaëlle; Machuca, Eduardo; Nevo, Fabien; Lescop, Ewen; Braun, Daniela A; Boschat, Anne-Claire; Sanquer, Sylvia; Guerrera, Ida Chiara; Revy, Patrick; Parisot, Mélanie; Masson, Cécile; Boddaert, Nathalie; Charbit, Marina; Decramer, Stéphane; Novo, Robert; Macher, Marie-Alice; Ranchin, Bruno; Bacchetta, Justine; Laurent, Audrey; Collardeau-Frachon, Sophie; van Eerde, Albertien M; Hildebrandt, Friedhelm; Magen, Daniella; Antignac, Corinne; van Tilbeurgh, Herman; Mollet, Géraldine. Defects in t(6)A tRNA modification due to GON7 and YRDC mutations lead to Galloway-Mowat syndrome. Nature Communications. 2019;10(1):3967. 

Dong, Xubin; Lv, Shihui; Gu, Dianna; Zhang, Xiaohua; Ye, Zhiqiang. Up-regulation of L Antigen Family Member 3 Associates With Aggressive Progression of Breast Cancer. Frontiers In Oncology. 10( 33552947):553628.